PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna12738.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 297aa    MW: 33076 Da    PI: 6.5973
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna12738.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.41.7e-131461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+ Ed  l +++k +G g W+  +++ g++R++k+c++rw++yl
  mrna12738.1-v1.0-hybrid 14 KGAWTALEDRVLSEYIKVHGEGGWRNLPKKAGLKRCGKSCRLRWLNYL 61
                             79********************************************97 PP

2Myb_DNA-binding53.94.2e-1767111147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg+ +++E+el+v+++k+lG++ W++Ia +++ gRt++++k++w++ 
  mrna12738.1-v1.0-hybrid  67 RGNISPDEEELIVRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNTN 111
                              7899******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-21564IPR009057Homeodomain-like
PROSITE profilePS5129414.496961IPR017930Myb domain
SuperFamilySSF466892.3E-2712108IPR009057Homeodomain-like
SMARTSM007171.4E-101363IPR001005SANT/Myb domain
PfamPF002498.0E-121461IPR001005SANT/Myb domain
CDDcd001674.75E-81661No hitNo description
PROSITE profilePS5129425.38662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-2465115IPR009057Homeodomain-like
SMARTSM007174.1E-1666114IPR001005SANT/Myb domain
PfamPF002495.1E-1567112IPR001005SANT/Myb domain
CDDcd001673.36E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MGRSPCCAKE GLNKGAWTAL EDRVLSEYIK VHGEGGWRNL PKKAGLKRCG KSCRLRWLNY  60
LRPDIKRGNI SPDEEELIVR LHKLLGNRWS LIAGRLPGRT DNEIKNYWNT NLSKRVPDQE  120
AHSSSPSSAG HGEPRSNKAK NVMSHNVVRT KAAKCTKVFI NPQLPRKGLL LADDHKPEDY  180
HRQQAVVDHQ PDGNGLSSPS LLENSSSSDF LMDFDMNSEL CLANLLGLEF SSGGDNLFSE  240
EMQLHQQYWS DNVGSGEDCV ADDQFQPTTI LNFQSLNSFL NADANQGDWL ELAETS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004287618.10.0PREDICTED: myb-related protein Hv1
TrEMBLM5WG391e-106M5WG39_PRUPE; Uncharacterized protein
STRINGVIT_11s0016g01300.t014e-88(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.18e-61MYB family protein